SCOP 1.75: Domain d2r7gc2: 2r7g C:644-785

Lineage for d2r7gc2 (2r7g C:644-785)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (6 PDB entries)

8. Domain d2r7gc2: 2r7g C:644-785 [151640]
   automatically matched to d1o9kb_
   complexed with so4

Details for d2r7gc2

PDB Entry: 2r7g, 1.67 Å

PDB Description: structure of the retinoblastoma protein pocket domain in complex with adenovirus e1a cr1 domain

PDB Compounds: (C:) Retinoblastoma-associated protein

SCOP Domain Sequences for d2r7gc2:

Sequence; same for both SEQRES and ATOM records:

>d2r7gc2 a.74.1.3 (C:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
lktnilqyastrpptlspiphi

Timeline for d2r7gc2:

• d2r7gc2 is new in SCOP 1.75
  
• d2r7gc2 appears in SCOPe 2.01
  
• d2r7gc2 appears in the current release, SCOPe 2.08