Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) |
Protein Retinoblastoma tumor suppressor domains [47970] (1 species) contains an additional C-terminal helix |
Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries) |
Domain d2r7gc2: 2r7g C:643-785 [151640] automated match to d1n4ma2 complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2r7g (more details), 1.67 Å
SCOPe Domain Sequences for d2r7gc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r7gc2 a.74.1.3 (C:643-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq rlktnilqyastrpptlspiphi
Timeline for d2r7gc2: