SCOPe 2.07: Domain d2r7ga2: 2r7g A:643-785

Lineage for d2r7ga2 (2r7g A:643-785)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)

8. Domain d2r7ga2: 2r7g A:643-785 [151638]
   automated match to d1n4ma2
   complexed with so4

Details for d2r7ga2

PDB Entry: 2r7g, 1.67 Å

PDB Description: structure of the retinoblastoma protein pocket domain in complex with adenovirus e1a cr1 domain

PDB Compounds: (A:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d2r7ga2:

Sequence; same for both SEQRES and ATOM records:

>d2r7ga2 a.74.1.3 (A:643-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq
immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq
rlktnilqyastrpptlspiphi

Timeline for d2r7ga2:

• d2r7ga2 first appeared in SCOP 1.75
  
• d2r7ga2 appears in SCOPe 2.06
  
• d2r7ga2 appears in the current release, SCOPe 2.08