Lineage for d2r7ga2 (2r7g A:643-785)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495899Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 1495900Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 1495901Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)
  8. 1495903Domain d2r7ga2: 2r7g A:643-785 [151638]
    automated match to d1n4ma2
    complexed with so4

Details for d2r7ga2

PDB Entry: 2r7g (more details), 1.67 Å

PDB Description: structure of the retinoblastoma protein pocket domain in complex with adenovirus e1a cr1 domain
PDB Compounds: (A:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d2r7ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7ga2 a.74.1.3 (A:643-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq
immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq
rlktnilqyastrpptlspiphi

SCOPe Domain Coordinates for d2r7ga2:

Click to download the PDB-style file with coordinates for d2r7ga2.
(The format of our PDB-style files is described here.)

Timeline for d2r7ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7ga1