Lineage for d2r7fa2 (2r7f A:3-403)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052173Family b.40.4.16: RNB domain-like [159112] (3 protein domains)
    Pfam PF00773; RNase II catalytic domain; decorated OB-fold domain with extra C-terminal structures forming the active site
  6. 2052185Protein Ribonuclease II family protein DR0020 [159115] (1 species)
    Includes extra N-terminal all-alpha subdomain
  7. 2052186Species Deinococcus radiodurans [TaxId:1299] [159116] (2 PDB entries)
    Uniprot Q9RYD0 3-403
  8. 2052190Domain d2r7fa2: 2r7f A:3-403 [151636]
    Other proteins in same PDB: d2r7fa1
    automated match to d2r7da2

Details for d2r7fa2

PDB Entry: 2r7f (more details), 2.7 Å

PDB Description: Crystal structure of ribonuclease II family protein from Deinococcus radiodurans, hexagonal crystal form. NorthEast Structural Genomics target DrR63
PDB Compounds: (A:) Ribonuclease II family protein

SCOPe Domain Sequences for d2r7fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7fa2 b.40.4.16 (A:3-403) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]}
qpeltpaqrtevellargradksrvlrdlklpetpeaahalllrlgvwdeartpyadrlr
aalnavelpvpdfdpaeerldlthlptfaiddegnqdpddavgvedlgggltrlwvhvad
vaalvapdspldlearargatlylpdrtigmlpdelvakaglglhevspalsicldldpd
gnaeavdvlltrvkvqrlayqeaqarleageepfvtlarlarasrrlregegalsidlpe
vrvkadetgasvfplpkpemrtvvqecmtlagwgtaifaddneiplpfatqdyptrevag
dtlpamwarrktlartrfqpspgphhgmgldlyaqatspmrryldlvvhqqlraflagrd
plsskvmaahiaesqmnadatrqaerlsrrhhtlrfiaaqp

SCOPe Domain Coordinates for d2r7fa2:

Click to download the PDB-style file with coordinates for d2r7fa2.
(The format of our PDB-style files is described here.)

Timeline for d2r7fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7fa1