SCOPe 2.05: Domain d2r7ca1: 2r7c A:144-313

Lineage for d2r7ca1 (2r7c A:144-313)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.2: Rotavirus NSP2 fragment, C-terminal domain [75347] (2 families)

5. Family d.13.2.1: Rotavirus NSP2 fragment, C-terminal domain [75348] (1 protein)

6. Protein Rotavirus NSP2 fragment, C-terminal domain [75349] (1 species)

7. Species Simian 11 rotavirus [TaxId:10923] [75350] (5 PDB entries)

8. Domain d2r7ca1: 2r7c A:144-313 [151627]
   Other proteins in same PDB: d2r7ca2
   automated match to d1l9va1
   complexed with po4

Details for d2r7ca1

PDB Entry: 2r7c, 2.7 Å

PDB Description: Crystallographic and biochemical analysis of rotavirus NSP2 with nucleotides reveals an NDP kinase like activity

PDB Compounds: (A:) Non-structural RNA-binding protein 35

SCOPe Domain Sequences for d2r7ca1:

Sequence, based on SEQRES records:

>d2r7ca1 d.13.2.1 (A:144-313) Rotavirus NSP2 fragment, C-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
keiettitaeggeivfqnaaftmwkltylehqlmpildqnfieykvtlnedkpisdvhvk
elvaelrwqynkfavithgkghyrivkyssvanhadrvyatfksnvktgvnndfnlldqr
iiwqnwyaftssmkqgntldvckrllfqkmkpeknpfkglstdrkmdevs

Sequence, based on observed residues (ATOM records):

>d2r7ca1 d.13.2.1 (A:144-313) Rotavirus NSP2 fragment, C-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
keiettitaeggeivfqnaaftmwkltylehqlmpildqnfieykvtlnedkpisdvhvk
elvaelrwqynkfavithgkghyrivkyssvanhadrvyatfksnvkndfnlldqriiwq
nwyaftssmkqgntldvckrllfqkmkpeknpfkglstdrkmdevs

Timeline for d2r7ca1:

• d2r7ca1 first appeared in SCOP 1.75
  
• d2r7ca1 appears in SCOPe 2.04
  
• d2r7ca1 appears in SCOPe 2.06
  
• d2r7ca1 appears in the current release, SCOPe 2.08