Lineage for d1mygb_ (1myg B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301229Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 2301235Domain d1mygb_: 1myg B: [15162]
    complexed with hem, so4; mutant

Details for d1mygb_

PDB Entry: 1myg (more details), 1.75 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)
PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d1mygb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mygb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1mygb_:

Click to download the PDB-style file with coordinates for d1mygb_.
(The format of our PDB-style files is described here.)

Timeline for d1mygb_: