Lineage for d2r6mb1 (2r6m B:7-192)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893087Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
  5. 893088Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 893089Protein Casein kinase II beta subunit [57800] (3 species)
  7. 893106Species Rattus norvegicus [TaxId:10116] [161172] (1 PDB entry)
  8. 893108Domain d2r6mb1: 2r6m B:7-192 [151619]
    automatically matched to d1jwhd_
    complexed with zn

Details for d2r6mb1

PDB Entry: 2r6m (more details), 3.1 Å

PDB Description: Crystal structure of rat CK2-beta subunit
PDB Compounds: (B:) Casein kinase II subunit beta

SCOP Domain Sequences for d2r6mb1:

Sequence, based on SEQRES records: (download)

>d2r6mb1 g.41.4.1 (B:7-192) Casein kinase II beta subunit {Rattus norvegicus [TaxId: 10116]}
vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeelednp
nqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsd
ipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvpr
lygfki

Sequence, based on observed residues (ATOM records): (download)

>d2r6mb1 g.41.4.1 (B:7-192) Casein kinase II beta subunit {Rattus norvegicus [TaxId: 10116]}
vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdnqsdlie
qaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeamv
klycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygfki

SCOP Domain Coordinates for d2r6mb1:

Click to download the PDB-style file with coordinates for d2r6mb1.
(The format of our PDB-style files is described here.)

Timeline for d2r6mb1: