Lineage for d2r6ma_ (2r6m A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036480Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
    automatically mapped to Pfam PF01214
  5. 3036481Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 3036482Protein Casein kinase II beta subunit [57800] (3 species)
  7. 3036505Species Norway rat (Rattus norvegicus) [TaxId:10116] [161172] (1 PDB entry)
  8. 3036506Domain d2r6ma_: 2r6m A: [151618]
    automated match to d1jwhd_
    complexed with zn

Details for d2r6ma_

PDB Entry: 2r6m (more details), 3.1 Å

PDB Description: Crystal structure of rat CK2-beta subunit
PDB Compounds: (A:) Casein kinase II subunit beta

SCOPe Domain Sequences for d2r6ma_:

Sequence, based on SEQRES records: (download)

>d2r6ma_ g.41.4.1 (A:) Casein kinase II beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeelednp
nqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsd
ipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvpr
lygfki

Sequence, based on observed residues (ATOM records): (download)

>d2r6ma_ g.41.4.1 (A:) Casein kinase II beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildleqsdlieqaa
emlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeamvkly
cpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygfki

SCOPe Domain Coordinates for d2r6ma_:

Click to download the PDB-style file with coordinates for d2r6ma_.
(The format of our PDB-style files is described here.)

Timeline for d2r6ma_: