SCOP 1.75: Domain d2r6kb2: 2r6k B:4-80

Lineage for d2r6kb2 (2r6k B:4-80)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (19 PDB entries)
   Uniprot P08263

8. Domain d2r6kb2: 2r6k B:4-80 [151617]
   Other proteins in same PDB: d2r6ka1, d2r6kb1
   automatically matched to d1gsea2
   complexed with gtx; mutant

Details for d2r6kb2

PDB Entry: 2r6k, 2.51 Å

PDB Description: crystal structure of an i71v hgsta1-1 mutant in complex with s- hexylglutathione

PDB Compounds: (B:) glutathione s-transferase a1

SCOP Domain Sequences for d2r6kb2:

Sequence; same for both SEQRES and ATOM records:

>d2r6kb2 c.47.1.5 (B:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
klvqtravlnyiaskyn

Timeline for d2r6kb2:

• d2r6kb2 is new in SCOP 1.75
  
• d2r6kb2 appears in SCOPe 2.01
  
• d2r6kb2 appears in the current release, SCOPe 2.08