Lineage for d2r6ib1 (2r6i B:1-261)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 883148Fold d.381: ATP12-like [160908] (1 superfamily)
    contains an N-terminal beta-sheet that forms a beta-triangle structure; the remainder is a multihelical array of long and short helices
  4. 883149Superfamily d.381.1: ATP12-like [160909] (1 family) (S)
  5. 883150Family d.381.1.1: ATP12-like [160910] (2 proteins)
    Pfam PF07542; F1-ATPase chaperone
  6. 883158Protein Uncharacterized protein Atu1473 [160911] (1 species)
  7. 883159Species Agrobacterium tumefaciens [TaxId:358] [160912] (1 PDB entry)
    Uniprot A9CJ14 1-261
  8. 883161Domain d2r6ib1: 2r6i B:1-261 [151613]
    automatically matched to 2R6I A:1-261

Details for d2r6ib1

PDB Entry: 2r6i (more details), 2.59 Å

PDB Description: Crystal structure of Atu1473 protein, a putative chaperone from Agrobacterium tumefaciens
PDB Compounds: (B:) Uncharacterized protein Atu1473

SCOP Domain Sequences for d2r6ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6ib1 d.381.1.1 (B:1-261) Uncharacterized protein Atu1473 {Agrobacterium tumefaciens [TaxId: 358]}
mrdllndlseglshpdpilraqiqmqkplpkrfykdvtvadveeggftilldgkplrtpa
kkplvapsraladllrdewdaqkevvnpvvmpvsrhvntaidgiasdtqavfedilrfss
sdllcyragdpealvarqtdywdpvldwatnvlgarfilvegvmhrdqpreaiaafavtl
kkydtpialaalhtmtsltgsailalalaegeltleeawalahldedwtaeqwgedeeal
erravrlidmraalnvleslk

SCOP Domain Coordinates for d2r6ib1:

Click to download the PDB-style file with coordinates for d2r6ib1.
(The format of our PDB-style files is described here.)

Timeline for d2r6ib1: