Lineage for d2r6ib2 (2r6i B:1-261)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011800Fold d.381: ATP12-like [160908] (1 superfamily)
    contains an N-terminal beta-sheet that forms a beta-triangle structure; the remainder is a multihelical array of long and short helices
  4. 3011801Superfamily d.381.1: ATP12-like [160909] (1 family) (S)
  5. 3011802Family d.381.1.1: ATP12-like [160910] (2 proteins)
    Pfam PF07542; F1-ATPase chaperone
  6. 3011810Protein Uncharacterized protein Atu1473 [160911] (1 species)
  7. 3011811Species Agrobacterium tumefaciens [TaxId:358] [160912] (1 PDB entry)
    Uniprot A9CJ14 1-261
  8. 3011813Domain d2r6ib2: 2r6i B:1-261 [151613]
    Other proteins in same PDB: d2r6ia2, d2r6ib3
    automated match to d2r6ia1

Details for d2r6ib2

PDB Entry: 2r6i (more details), 2.59 Å

PDB Description: Crystal structure of Atu1473 protein, a putative chaperone from Agrobacterium tumefaciens
PDB Compounds: (B:) Uncharacterized protein Atu1473

SCOPe Domain Sequences for d2r6ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6ib2 d.381.1.1 (B:1-261) Uncharacterized protein Atu1473 {Agrobacterium tumefaciens [TaxId: 358]}
mrdllndlseglshpdpilraqiqmqkplpkrfykdvtvadveeggftilldgkplrtpa
kkplvapsraladllrdewdaqkevvnpvvmpvsrhvntaidgiasdtqavfedilrfss
sdllcyragdpealvarqtdywdpvldwatnvlgarfilvegvmhrdqpreaiaafavtl
kkydtpialaalhtmtsltgsailalalaegeltleeawalahldedwtaeqwgedeeal
erravrlidmraalnvleslk

SCOPe Domain Coordinates for d2r6ib2:

Click to download the PDB-style file with coordinates for d2r6ib2.
(The format of our PDB-style files is described here.)

Timeline for d2r6ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r6ib3