SCOPe 2.02: Domain d1myga_: 1myg A:

Lineage for d1myga_ (1myg A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1myga_: 1myg A: [15161]
   complexed with hem, so4; mutant

Details for d1myga_

PDB Entry: 1myg, 1.75 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1myga_:

Sequence; same for both SEQRES and ATOM records:

>d1myga_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1myga_:

• d1myga_ first appeared (with stable ids) in SCOP 1.55
  
• d1myga_ appears in SCOPe 2.01
  
• d1myga_ appears in SCOPe 2.03
  
• d1myga_ appears in the current release, SCOPe 2.08