SCOPe 2.03: Domain d2r6gb1: 2r6g B:236-370

Lineage for d2r6gb1 (2r6g B:236-370)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.6: MOP-like [50331] (3 families)
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
probably stems out from the biMOP domain
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
Species Escherichia coli [TaxId:562] [101772] (13 PDB entries)
Domain d2r6gb1: 2r6g B:236-370 [151606]
Other proteins in same PDB: d2r6ga2, d2r6gb2, d2r6ge_, d2r6gf1, d2r6gf2, d2r6gg1
automatically matched to d1q12a1
complexed with atp, mal

Details for d2r6gb1

PDB Entry: 2r6g (more details), 2.8 Å

PDB Description: the crystal structure of the e. coli maltose transporter

PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2r6gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6gb1 b.40.6.3 (B:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOPe Domain Coordinates for d2r6gb1:

Click to download the PDB-style file with coordinates for d2r6gb1.
(The format of our PDB-style files is described here.)

Timeline for d2r6gb1: