SCOPe 2.01: Domain d2r6gb1: 2r6g B:236-370

Lineage for d2r6gb1 (2r6g B:236-370)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (3 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (6 PDB entries)

8. Domain d2r6gb1: 2r6g B:236-370 [151606]
   Other proteins in same PDB: d2r6ga2, d2r6gb2, d2r6ge_, d2r6gf1, d2r6gf2, d2r6gg1
   automatically matched to d1q12a1
   complexed with atp, mal

Details for d2r6gb1

PDB Entry: 2r6g, 2.8 Å

PDB Description: the crystal structure of the e. coli maltose transporter

PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2r6gb1:

Sequence; same for both SEQRES and ATOM records:

>d2r6gb1 b.40.6.3 (B:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

Timeline for d2r6gb1:

• d2r6gb1 first appeared in SCOP 1.75
  
• d2r6gb1 appears in SCOPe 2.02
  
• d2r6gb1 appears in the current release, SCOPe 2.08