| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
| Species Escherichia coli [TaxId:562] [102380] (6 PDB entries) |
| Domain d2r6ga2: 2r6g A:4-235 [151605] Other proteins in same PDB: d2r6ga1, d2r6gb1, d2r6ge_, d2r6gf1, d2r6gf2, d2r6gg1 automatically matched to d1q12a2 complexed with atp, mal |
PDB Entry: 2r6g (more details), 2.8 Å
SCOPe Domain Sequences for d2r6ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r6ga2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig
ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql
ahlldrkpkalsggqrqrvaigrtlvaepsvflldqplsnldaalrvqmrieisrlhkrl
grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig
Timeline for d2r6ga2: