Lineage for d2r6ga2 (2r6g A:4-235)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989641Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 989753Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 989754Species Escherichia coli [TaxId:562] [102380] (6 PDB entries)
  8. 989763Domain d2r6ga2: 2r6g A:4-235 [151605]
    Other proteins in same PDB: d2r6ga1, d2r6gb1, d2r6ge_, d2r6gf1, d2r6gf2, d2r6gg1
    automatically matched to d1q12a2
    complexed with atp, mal

Details for d2r6ga2

PDB Entry: 2r6g (more details), 2.8 Å

PDB Description: the crystal structure of the e. coli maltose transporter
PDB Compounds: (A:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2r6ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6ga2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig
ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql
ahlldrkpkalsggqrqrvaigrtlvaepsvflldqplsnldaalrvqmrieisrlhkrl
grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d2r6ga2:

Click to download the PDB-style file with coordinates for d2r6ga2.
(The format of our PDB-style files is described here.)

Timeline for d2r6ga2: