![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries) |
![]() | Domain d2r69l1: 2r69 L:1-111 [151602] Other proteins in same PDB: d2r69a1, d2r69l2 automatically matched to d1ejol1 |
PDB Entry: 2r69 (more details), 3.8 Å
SCOPe Domain Sequences for d2r69l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r69l1 b.1.1.1 (L:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} divltqspaslavslgqratiscrasesvvrygnsfmhwyqqkpgqppklliyrassles giptrfsgsgsrtdftltinpveaddvatyycqqtnvdpwafgggtkleik
Timeline for d2r69l1: