Lineage for d2r69l1 (2r69 L:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741155Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 2741195Domain d2r69l1: 2r69 L:1-111 [151602]
    Other proteins in same PDB: d2r69a1, d2r69l2
    automatically matched to d1ejol1

Details for d2r69l1

PDB Entry: 2r69 (more details), 3.8 Å

PDB Description: crystal structure of fab 1a1d-2 complexed with e-diii of dengue virus at 3.8 angstrom resolution
PDB Compounds: (L:) Light chain of 1A1D-2

SCOPe Domain Sequences for d2r69l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r69l1 b.1.1.1 (L:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratiscrasesvvrygnsfmhwyqqkpgqppklliyrassles
giptrfsgsgsrtdftltinpveaddvatyycqqtnvdpwafgggtkleik

SCOPe Domain Coordinates for d2r69l1:

Click to download the PDB-style file with coordinates for d2r69l1.
(The format of our PDB-style files is described here.)

Timeline for d2r69l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r69l2
View in 3D
Domains from other chains:
(mouse over for more information)
d2r69a1