SCOPe 2.04: Domain d2r69a1: 2r69 A:298-394

Lineage for d2r69a1 (2r69 A:298-394)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (9 PDB entries)
   Uniprot P12823 281-675 # 99% sequence identity

8. Domain d2r69a1: 2r69 A:298-394 [151601]
   Other proteins in same PDB: d2r69l1, d2r69l2
   automatically matched to d1tgea1

Details for d2r69a1

PDB Entry: 2r69, 3.8 Å

PDB Description: crystal structure of fab 1a1d-2 complexed with e-diii of dengue virus at 3.8 angstrom resolution

PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d2r69a1:

Sequence; same for both SEQRES and ATOM records:

>d2r69a1 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d2r69a1:

• d2r69a1 first appeared in SCOP 1.75
  
• d2r69a1 appears in SCOPe 2.03
  
• d2r69a1 appears in SCOPe 2.05
  
• d2r69a1 appears in the current release, SCOPe 2.08