Lineage for d2r61a2 (2r61 A:101-204)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894684Protein Superantigen-like protein SET3 [75370] (1 species)
  7. 1894685Species Staphylococcus aureus [TaxId:1280] [75371] (3 PDB entries)
  8. 1894689Domain d2r61a2: 2r61 A:101-204 [151600]
    Other proteins in same PDB: d2r61a1
    automated match to d2z8la2
    complexed with cl, gol, srt

Details for d2r61a2

PDB Entry: 2r61 (more details), 2.75 Å

PDB Description: crystal structure of the staphylococcal superantigen-like protein ssl5 in complex with sialyl-lewis x at ph 7.4
PDB Compounds: (A:) Exotoxin 3

SCOPe Domain Sequences for d2r61a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r61a2 d.15.6.1 (A:101-204) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
ayydylnapkfvikkevdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpk
dskikvimkdggyytfelnkklqphrmsdvidgrniekmeanir

SCOPe Domain Coordinates for d2r61a2:

Click to download the PDB-style file with coordinates for d2r61a2.
(The format of our PDB-style files is described here.)

Timeline for d2r61a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r61a1