Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Superantigen-like protein SET3 [75370] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [75371] (3 PDB entries) |
Domain d2r61a2: 2r61 A:101-204 [151600] Other proteins in same PDB: d2r61a1 automated match to d2z8la2 complexed with cl, gol, srt |
PDB Entry: 2r61 (more details), 2.75 Å
SCOPe Domain Sequences for d2r61a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r61a2 d.15.6.1 (A:101-204) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]} ayydylnapkfvikkevdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpk dskikvimkdggyytfelnkklqphrmsdvidgrniekmeanir
Timeline for d2r61a2: