Lineage for d2r5nb3 (2r5n B:528-663)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1370884Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1370885Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1370886Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 1370905Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 1370921Species Escherichia coli [TaxId:562] [89712] (4 PDB entries)
  8. 1370925Domain d2r5nb3: 2r5n B:528-663 [151596]
    Other proteins in same PDB: d2r5na1, d2r5na2, d2r5nb1, d2r5nb2
    automatically matched to d1qgda3
    complexed with ca, edo, r5p, rp5, tpp

Details for d2r5nb3

PDB Entry: 2r5n (more details), 1.6 Å

PDB Description: crystal structure of transketolase from escherichia coli in noncovalent complex with acceptor aldose ribose 5-phosphate
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d2r5nb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5nb3 c.48.1.1 (B:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOPe Domain Coordinates for d2r5nb3:

Click to download the PDB-style file with coordinates for d2r5nb3.
(The format of our PDB-style files is described here.)

Timeline for d2r5nb3: