SCOP 1.75: Domain d2r5nb3: 2r5n B:528-663

Lineage for d2r5nb3 (2r5n B:528-663)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)

6. Protein Transketolase (TK), C-domain [52924] (4 species)
   two N-terminal domains are PP and Pyr modules of thiamin-binding fold

7. Species Escherichia coli [TaxId:562] [89712] (4 PDB entries)

8. Domain d2r5nb3: 2r5n B:528-663 [151596]
   Other proteins in same PDB: d2r5na1, d2r5na2, d2r5nb1, d2r5nb2
   automatically matched to d1qgda3
   complexed with ca, edo, r5p, rp5, tpp

Details for d2r5nb3

PDB Entry: 2r5n, 1.6 Å

PDB Description: crystal structure of transketolase from escherichia coli in noncovalent complex with acceptor aldose ribose 5-phosphate

PDB Compounds: (B:) Transketolase 1

SCOP Domain Sequences for d2r5nb3:

Sequence; same for both SEQRES and ATOM records:

>d2r5nb3 c.48.1.1 (B:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

Timeline for d2r5nb3:

• d2r5nb3 is new in SCOP 1.75
  
• d2r5nb3 appears in SCOPe 2.01
  
• d2r5nb3 appears in the current release, SCOPe 2.08