SCOPe 2.07: Domain d2r5nb1: 2r5n B:333-527

Lineage for d2r5nb1 (2r5n B:333-527)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255574] (3 PDB entries)

8. Domain d2r5nb1: 2r5n B:333-527 [151594]
   Other proteins in same PDB: d2r5na2, d2r5na3, d2r5na4, d2r5nb2, d2r5nb3, d2r5nb4
   automated match to d2r8oa1
   complexed with ca, edo, r5p, rp5, tpp

Details for d2r5nb1

PDB Entry: 2r5n, 1.6 Å

PDB Description: crystal structure of transketolase from escherichia coli in noncovalent complex with acceptor aldose ribose 5-phosphate

PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d2r5nb1:

Sequence; same for both SEQRES and ATOM records:

>d2r5nb1 c.36.1.0 (B:333-527) automated matches {Escherichia coli [TaxId: 562]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

Timeline for d2r5nb1:

• d2r5nb1 first appeared in SCOP 1.75
  
• d2r5nb1 appears in SCOPe 2.06
  
• d2r5nb1 appears in the current release, SCOPe 2.08