Lineage for d2r5na3 (2r5n A:528-663)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880616Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 2880635Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 2880651Species Escherichia coli [TaxId:562] [89712] (4 PDB entries)
  8. 2880652Domain d2r5na3: 2r5n A:528-663 [151593]
    Other proteins in same PDB: d2r5na1, d2r5na2, d2r5na4, d2r5nb1, d2r5nb2, d2r5nb4
    automated match to d2r8oa3
    complexed with ca, edo, r5p, rp5, tpp

Details for d2r5na3

PDB Entry: 2r5n (more details), 1.6 Å

PDB Description: crystal structure of transketolase from escherichia coli in noncovalent complex with acceptor aldose ribose 5-phosphate
PDB Compounds: (A:) Transketolase 1

SCOPe Domain Sequences for d2r5na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5na3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOPe Domain Coordinates for d2r5na3:

Click to download the PDB-style file with coordinates for d2r5na3.
(The format of our PDB-style files is described here.)

Timeline for d2r5na3: