Lineage for d2r5na2 (2r5n A:2-332)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473216Family c.36.1.10: TK-like PP module [88760] (3 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2473235Protein Transketolase (TK), PP module [88761] (4 species)
  7. 2473251Species Escherichia coli [TaxId:562] [89656] (4 PDB entries)
  8. 2473252Domain d2r5na2: 2r5n A:2-332 [151592]
    Other proteins in same PDB: d2r5na1, d2r5na3, d2r5na4, d2r5nb1, d2r5nb3, d2r5nb4
    automated match to d1qgda2
    complexed with ca, edo, r5p, rp5, tpp

Details for d2r5na2

PDB Entry: 2r5n (more details), 1.6 Å

PDB Description: crystal structure of transketolase from escherichia coli in noncovalent complex with acceptor aldose ribose 5-phosphate
PDB Compounds: (A:) Transketolase 1

SCOPe Domain Sequences for d2r5na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5na2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]}
ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
akesawnekfaayakaypqeaaeftrrmkge

SCOPe Domain Coordinates for d2r5na2:

Click to download the PDB-style file with coordinates for d2r5na2.
(The format of our PDB-style files is described here.)

Timeline for d2r5na2: