Lineage for d2r5fa1 (2r5f A:59-316)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151216Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 protein domains)
    Pfam PF04198
  6. 2151235Protein Transcriptional regulator PSPTO2395 [159546] (1 species)
  7. 2151236Species Pseudomonas syringae [TaxId:317] [159547] (1 PDB entry)
    Uniprot Q883G8 59-316
  8. 2151237Domain d2r5fa1: 2r5f A:59-316 [151590]
    complexed with so4

Details for d2r5fa1

PDB Entry: 2r5f (more details), 2.1 Å

PDB Description: putative sugar-binding domain of transcriptional regulator deor from pseudomonas syringae pv. tomato
PDB Compounds: (A:) Transcriptional regulator, putative

SCOPe Domain Sequences for d2r5fa1:

Sequence, based on SEQRES records: (download)

>d2r5fa1 c.124.1.8 (A:59-316) Transcriptional regulator PSPTO2395 {Pseudomonas syringae [TaxId: 317]}
qglhleletrlqkmygirqvivveatepddeesikqaigsaaahyletslsaqdhigiss
wsstiramvshmhpqpgkqsaqevvqllggvgnkgafeatlltqrlatllncpafllpsq
sieqsveskqrivemeevkevlhrfdsitlaivgigelepsqllrnsgnyytedmlrvla
ergavgdiclryfdaqgkpvleedeefvvsmglgklrsinrvlglaggvrkvqaikgall
ggyldvlitdvgtarglg

Sequence, based on observed residues (ATOM records): (download)

>d2r5fa1 c.124.1.8 (A:59-316) Transcriptional regulator PSPTO2395 {Pseudomonas syringae [TaxId: 317]}
qglhleletrlqkmygirqvivveatepddeesikqaigsaaahyletslsaqdhigiss
wsstiramvshmhpgkqsaqevvqllggvggafeatlltqrlatllncpafllpsqrive
meevkevlhrfdsitlaivgigelelaergavgdiclryfdaqgkpvvvsmglgklrsin
rvlglaggvrkvqaikgallggyldvlitdvgtarglg

SCOPe Domain Coordinates for d2r5fa1:

Click to download the PDB-style file with coordinates for d2r5fa1.
(The format of our PDB-style files is described here.)

Timeline for d2r5fa1: