SCOPe 2.06: Domain d2r5ca_: 2r5c A:

Lineage for d2r5ca_ (2r5c A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species)

7. Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [142654] (4 PDB entries)
   Uniprot Q95VY4 61-477

8. Domain d2r5ca_: 2r5c A: [151586]
   automated match to d1yiya1
   complexed with c6p

Details for d2r5ca_

PDB Entry: 2r5c, 1.96 Å

PDB Description: Aedes Kynurenine Aminotransferase in Complex with Cysteine

PDB Compounds: (A:) Kynurenine aminotransferase

SCOPe Domain Sequences for d2r5ca_:

Sequence; same for both SEQRES and ATOM records:

>d2r5ca_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
nkfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdpla
nqytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdevii
iepffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiint
phnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertiti
gsagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlksp
ecyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkd
yrftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

Timeline for d2r5ca_:

• d2r5ca_ first appeared in SCOP 1.75, called d2r5ca1
  
• d2r5ca_ appears in SCOPe 2.05
  
• d2r5ca_ appears in SCOPe 2.07
  
• d2r5ca_ appears in the current release, SCOPe 2.08