Lineage for d2r59a2 (2r59 A:1-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820569Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2820585Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2820586Species Human (Homo sapiens) [TaxId:9606] [63740] (58 PDB entries)
    Uniprot P09960
  8. 2820616Domain d2r59a2: 2r59 A:1-208 [151584]
    Other proteins in same PDB: d2r59a1, d2r59a3
    automated match to d3b7sa2
    complexed with acy, ph0, yb, zn

Details for d2r59a2

PDB Entry: 2r59 (more details), 1.89 Å

PDB Description: leukotriene a4 hydrolase complexed with inhibitor rb3041
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d2r59a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r59a2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
pedpsrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d2r59a2:

Click to download the PDB-style file with coordinates for d2r59a2.
(The format of our PDB-style files is described here.)

Timeline for d2r59a2: