![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.15: CHU142-like [159988] (1 protein) single domain covered by PfamB PB000743 in the N-terminal part and PfamB PB000860 in the C-terminal part |
![]() | Protein Uncharacterized protein CHU142 [159989] (1 species) |
![]() | Species Cytophaga hutchinsonii [TaxId:985] [159990] (1 PDB entry) Uniprot Q11V67 1-122 |
![]() | Domain d2r4ia1: 2r4i A:1-122 [151576] Other proteins in same PDB: d2r4ia2 complexed with cit, gol, ipa |
PDB Entry: 2r4i (more details), 1.6 Å
SCOPe Domain Sequences for d2r4ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} mnqrdvildcekklltaiqnndveslevllhddllfiipsgetvtketdiaayssgkial ravvpsdyiiriihdtvvvsvnieikgeymehtldntfrylrvwklfdgnwkviagscta ig
Timeline for d2r4ia1: