Lineage for d2r42a2 (2r42 A:226-395)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) 
common fold is elaborated with additional secondary structures
Family d.58.26.3: Mevalonate kinase [75450] (1 protein) Protein Mevalonate kinase [75451] (3 species) 
Species Norway rat (Rattus norvegicus) [TaxId:10116] [75453] (2 PDB entries) 
Domain d2r42a2: 2r42 A:226-395 [151574]
Other proteins in same PDB: d2r42a1
automated match to d1kvka2
complexed with fps, mg
Details for d2r42a2
PDB Entry: 2r42 (more details), 2.4 Å
PDB Description: The Biochemical and Structural Basis for feedback Inhibition of Mevalonate Kinase and Isoprenoid Metabolism
PDB Compounds: (A:) Mevalonate KinaseSCOPe Domain Sequences for d2r42a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r42a2 d.58.26.3 (A:226-395) Mevalonate kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpalqilltntkvprstkalvagvrsrlikfpeimaplltsidaislecervlgemaaa
pvpeqylvleelmdmnqhhlnalgvghasldqlcqvtaahglhskltgaggggcgitllk
pglerakveaakqaltgcgfdcwetsigapgvsmhsatsiedpvrqalgl
SCOPe Domain Coordinates for d2r42a2:
Click to download the PDB-style file with coordinates for d2r42a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r42a2:
- d2r42a2 first appeared in SCOP 1.75
- d2r42a2 appears in SCOPe 2.07
View in 3D
