Lineage for d2r42a1 (2r42 A:1-225)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157803Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 protein domains)
  6. 2157849Protein Mevalonate kinase [75353] (3 species)
  7. 2157858Species Norway rat (Rattus norvegicus) [TaxId:10116] [75355] (2 PDB entries)
  8. 2157860Domain d2r42a1: 2r42 A:1-225 [151573]
    Other proteins in same PDB: d2r42a2
    automated match to d1kvka1
    complexed with fps, mg

Details for d2r42a1

PDB Entry: 2r42 (more details), 2.4 Å

PDB Description: The Biochemical and Structural Basis for feedback Inhibition of Mevalonate Kinase and Isoprenoid Metabolism
PDB Compounds: (A:) Mevalonate Kinase

SCOPe Domain Sequences for d2r42a1:

Sequence, based on SEQRES records: (download)

>d2r42a1 d.14.1.5 (A:1-225) Mevalonate kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlsevllvsapgkvilhgehavvhgkvalavalnlrtflvlrpqsngkvslnlpnvgikq
vwdvatlqlldtgfleqgdvpaptleqleklkkvaglprdcvgneglsllaflylylaic
rkqrtlpsldimvwselppgaglgssaaysvcvaaalltaceevtnplkdrgsigswpee
dlksinkwayegervihgnpsgvdnsvstwggalryqqgkmsslk

Sequence, based on observed residues (ATOM records): (download)

>d2r42a1 d.14.1.5 (A:1-225) Mevalonate kinase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlsevllvsapgkvilhgehavvhgkvalavalnlrtflvlrpqsngkvslnlpnvgikq
vwdvatlqlldtgfqleklkkvaglprdcvgneglsllaflylylaicrkqrtlpsldim
vwselppgaglgssaaysvcvaaalltaceevtnplkdrgsigswpeedlksinkwayeg
ervihgnpsgvdnsvstwggalryqqgkmsslk

SCOPe Domain Coordinates for d2r42a1:

Click to download the PDB-style file with coordinates for d2r42a1.
(The format of our PDB-style files is described here.)

Timeline for d2r42a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r42a2