Lineage for d2r40d_ (2r40 D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Ecdysone receptor [101436] (1 species)
  7. Species Tobacco budworm (Heliothis virescens) [TaxId:7102] [101437] (3 PDB entries)
  8. Domain d2r40d_: 2r40 D: [151572]
    Other proteins in same PDB: d2r40a_
    automated match to d1r1kd_
    complexed with 20e, eph, flc, gol, so4

Details for d2r40d_

PDB Entry: 2r40 (more details), 2.4 Å

PDB Description: crystal structure of 20e bound ecr/usp
PDB Compounds: (D:) Ecdysone receptor

SCOPe Domain Sequences for d2r40d_:

Sequence, based on SEQRES records: (download)

>d2r40d_ a.123.1.1 (D:) Ecdysone receptor {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
vppltanqksliarlvwyqegyeqpseedlkrvtqtwqsdeddedsdmpfrqitemtilt
vqlivefakglpgfakisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrd
nyrkagmayviedllhfcrcmysmmmdnvhyalltaivifsdrpgleqpllveeiqryyl
ntlrvyilnqnsasprcavifgkilgilteirtlgmqnsnmcislklknrklppfleeiw
dva

Sequence, based on observed residues (ATOM records): (download)

>d2r40d_ a.123.1.1 (D:) Ecdysone receptor {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
vppltanqksliarlvwyqegyeqpseedlkrvtqtdmpfrqitemtiltvqlivefakg
lpgfakisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrdnyrkagmayv
iedllhfcrcmysmmmdnvhyalltaivifsdrpgleqpllveeiqryylntlrvyilnq
nsasprcavifgkilgilteirtlgmqnsnmcislklknrklppfleeiwdva

SCOPe Domain Coordinates for d2r40d_ are not available.

Timeline for d2r40d_:

Domains from other chains:
(mouse over for more information)
d2r40a_