Lineage for d2r40a_ (2r40 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009668Species Tobacco budworm (Heliothis virescens) [TaxId:7102] [187215] (1 PDB entry)
  8. 2009669Domain d2r40a_: 2r40 A: [151571]
    Other proteins in same PDB: d2r40d_
    automated match to d1g2na_
    complexed with 20e, eph, flc, gol, so4

Details for d2r40a_

PDB Entry: 2r40 (more details), 2.4 Å

PDB Description: crystal structure of 20e bound ecr/usp
PDB Compounds: (A:) ultraspiracle

SCOPe Domain Sequences for d2r40a_:

Sequence, based on SEQRES records: (download)

>d2r40a_ a.123.1.1 (A:) automated matches {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
qelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwar
diphfsqlemedqillikgswnelllfaiawrsmeflteerdgvdgtgnrttsppqlmcl
mpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknr
qevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadts
iagyirdalr

Sequence, based on observed residues (ATOM records): (download)

>d2r40a_ a.123.1.1 (A:) automated matches {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
qelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwar
diphfsqlemedqillikgswnelllfaiawrsmefltttsppqlmclmpgmtlhrnsal
qagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknrqevevlrekmfl
cldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadtsiagyirdalr

SCOPe Domain Coordinates for d2r40a_:

Click to download the PDB-style file with coordinates for d2r40a_.
(The format of our PDB-style files is described here.)

Timeline for d2r40a_: