SCOPe 2.08: Domain d2r3yb2: 2r3y B:43-254

Lineage for d2r3yb2 (2r3y B:43-254)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d2r3yb2: 2r3y B:43-254 [151568]
   Other proteins in same PDB: d2r3ya1, d2r3yb1, d2r3yc1
   automatically matched to d1te0a2

Details for d2r3yb2

PDB Entry: 2r3y, 2.5 Å

PDB Description: Crystal structure of the DegS protease in complex with the YWF activating peptide

PDB Compounds: (B:) Protease degS

SCOPe Domain Sequences for d2r3yb2:

Sequence, based on SEQRES records:

>d2r3yb2 b.47.1.1 (B:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklirdgrv

Sequence, based on observed residues (ATOM records):

>d2r3yb2 b.47.1.1 (B:43-254) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglqleirtlgsgvimdqrgyiitnkhvindadqiival
qdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqti
tqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdksndget
pegigfaipfqlatkimdklirdgrv

Timeline for d2r3yb2:

• d2r3yb2 first appeared in SCOP 1.75
  
• d2r3yb2 appears in SCOPe 2.07