SCOP 1.75: Domain d2r3yb1: 2r3y B:255-352

Lineage for d2r3yb1 (2r3y B:255-352)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (6 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)

7. Species Escherichia coli [TaxId:562] [110189] (5 PDB entries)
   Uniprot P31137 37-354
   Uniprot P31137
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d2r3yb1: 2r3y B:255-352 [151567]
   Other proteins in same PDB: d2r3ya2, d2r3yb2, d2r3yc2
   automatically matched to d1te0a1

Details for d2r3yb1

PDB Entry: 2r3y, 2.5 Å

PDB Description: Crystal structure of the DegS protease in complex with the YWF activating peptide

PDB Compounds: (B:) Protease degS

SCOP Domain Sequences for d2r3yb1:

Sequence, based on SEQRES records:

>d2r3yb1 b.36.1.4 (B:255-352) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeyp

Sequence, based on observed residues (ATOM records):

>d2r3yb1 b.36.1.4 (B:255-352) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggivvnevspdgpaanagiqvndliisvdnkpatmdqvaeirpgsvipvvvlq
vtiqeyp

Timeline for d2r3yb1:

• d2r3yb1 is new in SCOP 1.75
  
• d2r3yb1 appears in SCOPe 2.01
  
• d2r3yb1 appears in the current release, SCOPe 2.08