Lineage for d2r3ya1 (2r3y A:255-352)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396041Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 2396085Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)
  7. 2396086Species Escherichia coli [TaxId:562] [110189] (6 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2396090Domain d2r3ya1: 2r3y A:255-352 [151565]
    Other proteins in same PDB: d2r3ya2, d2r3yb2, d2r3yc2
    automatically matched to d1te0a1

Details for d2r3ya1

PDB Entry: 2r3y (more details), 2.5 Å

PDB Description: Crystal structure of the DegS protease in complex with the YWF activating peptide
PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d2r3ya1:

Sequence, based on SEQRES records: (download)

>d2r3ya1 b.36.1.4 (A:255-352) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeyp

Sequence, based on observed residues (ATOM records): (download)

>d2r3ya1 b.36.1.4 (A:255-352) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]}
irgyigiggivvnevspdgpaanagiqvndliisvdnkpatmdqvaeirpgsvipvvvlq
vtiqeyp

SCOPe Domain Coordinates for d2r3ya1:

Click to download the PDB-style file with coordinates for d2r3ya1.
(The format of our PDB-style files is described here.)

Timeline for d2r3ya1: