Lineage for d2r3xb1 (2r3x B:81-222)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769718Protein Class alpha GST [81349] (8 species)
  7. 769738Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (19 PDB entries)
    Uniprot P08263
  8. 769750Domain d2r3xb1: 2r3x B:81-222 [151563]
    Other proteins in same PDB: d2r3xa2, d2r3xb2
    automatically matched to d1gsea1
    complexed with gtx; mutant

Details for d2r3xb1

PDB Entry: 2r3x (more details), 1.8 Å

PDB Description: crystal structure of an r15l hgsta1-1 mutant complexed with s-hexyl- glutathione
PDB Compounds: (B:) glutathione s-transferase a1

SCOP Domain Sequences for d2r3xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3xb1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOP Domain Coordinates for d2r3xb1:

Click to download the PDB-style file with coordinates for d2r3xb1.
(The format of our PDB-style files is described here.)

Timeline for d2r3xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r3xb2