Lineage for d2r3xa2 (2r3x A:2-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876600Protein Class alpha GST [81360] (8 species)
  7. 2876613Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries)
    Uniprot P08263
  8. 2876637Domain d2r3xa2: 2r3x A:2-80 [151562]
    Other proteins in same PDB: d2r3xa1, d2r3xb1
    automated match to d1gsea2
    complexed with gtx; mutant

Details for d2r3xa2

PDB Entry: 2r3x (more details), 1.8 Å

PDB Description: crystal structure of an r15l hgsta1-1 mutant complexed with s-hexyl- glutathione
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d2r3xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3xa2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnarglmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d2r3xa2:

Click to download the PDB-style file with coordinates for d2r3xa2.
(The format of our PDB-style files is described here.)

Timeline for d2r3xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r3xa1