![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins) |
![]() | Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110237] (9 PDB entries) Uniprot P31137 37-354 Uniprot P31137 Uniprot P31137 37-354 ! Uniprot P31137 |
![]() | Domain d2r3uc1: 2r3u C:42-251 [151560] automatically matched to d1sota2 mutant |
PDB Entry: 2r3u (more details), 2.6 Å
SCOP Domain Sequences for d2r3uc1:
Sequence, based on SEQRES records: (download)
>d2r3uc1 b.47.1.1 (C:42-251) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd ksndgetpegigfaipfqlatkimdklird
>d2r3uc1 b.47.1.1 (C:42-251) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} mtpasynlavrraapavvnvynrleirtlgsgvimdqrgyiitnkhvindadqiivalqd grvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqtitq giisatgnflqtdasinhgnsggalvnslgelmgintlsfdtpegigfaipfqlatkimd klird
Timeline for d2r3uc1: