![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Myoglobin [46469] (9 species) |
![]() | Species Common seal (Phoca vitulina) [TaxId:9720] [46472] (1 PDB entry) |
![]() | Domain d1mbs__: 1mbs - [15156] complexed with hem |
PDB Entry: 1mbs (more details), 2.5 Å
SCOP Domain Sequences for d1mbs__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbs__ a.1.1.2 (-) Myoglobin {Common seal (Phoca vitulina)} glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp aefgadaqaamkkalelfrndiaakykelgfhg
Timeline for d1mbs__: