Lineage for d1mbs__ (1mbs -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 533Protein Myoglobin [46469] (9 species)
  7. 536Species Common seal (Phoca vitulina) [TaxId:9720] [46472] (1 PDB entry)
  8. 537Domain d1mbs__: 1mbs - [15156]

Details for d1mbs__

PDB Entry: 1mbs (more details), 2.5 Å

PDB Description: x-ray crystallographic studies of seal myoglobin. the molecule at 2.5 angstroms resolution

SCOP Domain Sequences for d1mbs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbs__ a.1.1.2 (-) Myoglobin {Common seal (Phoca vitulina)}
glsdgewhlvlnvwgkvetdlaghgqevlirlfkshpetlekfdkfkhlkseddmrrsed
lrkhgntvltalggilkkkghheaelkplaqshatkhkipikylefiseaiihvlhskhp
aefgadaqaamkkalelfrndiaakykelgfhg

SCOP Domain Coordinates for d1mbs__:

Click to download the PDB-style file with coordinates for d1mbs__.
(The format of our PDB-style files is described here.)

Timeline for d1mbs__: