Lineage for d2r3ua_ (2r3u A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055770Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 2055771Species Escherichia coli [TaxId:562] [110237] (12 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 2055799Domain d2r3ua_: 2r3u A: [151558]
    automated match to d2r3ua1
    mutant

Details for d2r3ua_

PDB Entry: 2r3u (more details), 2.6 Å

PDB Description: Crystal structure of the PDZ deletion mutant of DegS
PDB Compounds: (A:) Protease degS

SCOPe Domain Sequences for d2r3ua_:

Sequence, based on SEQRES records: (download)

>d2r3ua_ b.47.1.1 (A:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
mtpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklird

Sequence, based on observed residues (ATOM records): (download)

>d2r3ua_ b.47.1.1 (A:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
mtpasynlavrraapavvnvynrglnnqleirtlgsgvimdqrgyiitnkhvindadqii
valqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlg
qtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdketp
egigfaipfqlatkimdklird

SCOPe Domain Coordinates for d2r3ua_:

Click to download the PDB-style file with coordinates for d2r3ua_.
(The format of our PDB-style files is described here.)

Timeline for d2r3ua_: