Lineage for d2r3ca1 (2r3c A:1-45)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042100Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 3042177Species Synthetic construct [TaxId:32630] [161260] (1 PDB entry)
  8. 3042178Domain d2r3ca1: 2r3c A:1-45 [151556]
    automatically matched to d1czqa_
    complexed with cl, yt3

Details for d2r3ca1

PDB Entry: 2r3c (more details), 1.73 Å

PDB Description: structure of the gp41 n-peptide in complex with the hiv entry inhibitor pie1
PDB Compounds: (A:) gp41 N-peptide

SCOPe Domain Sequences for d2r3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3ca1 h.3.2.1 (A:1-45) Retrovius gp41 protease-resistant core {Synthetic construct [TaxId: 32630]}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril

SCOPe Domain Coordinates for d2r3ca1:

Click to download the PDB-style file with coordinates for d2r3ca1.
(The format of our PDB-style files is described here.)

Timeline for d2r3ca1: