![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
![]() | Family h.3.2.1: Virus ectodomain [58070] (9 proteins) |
![]() | Protein Retrovius gp41 protease-resistant core [58071] (4 species) coiled coil; biological unit: trimer |
![]() | Species Synthetic construct [TaxId:32630] [161260] (1 PDB entry) |
![]() | Domain d2r3ca1: 2r3c A:1-45 [151556] automatically matched to d1czqa_ complexed with cl, yt3 |
PDB Entry: 2r3c (more details), 1.73 Å
SCOPe Domain Sequences for d2r3ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r3ca1 h.3.2.1 (A:1-45) Retrovius gp41 protease-resistant core {Synthetic construct [TaxId: 32630]} rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
Timeline for d2r3ca1: