Lineage for d4mbaa_ (4mba A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632833Protein Myoglobin [46469] (9 species)
  7. 632910Species Sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 632917Domain d4mbaa_: 4mba A: [15155]
    complexed with hem, imd

Details for d4mbaa_

PDB Entry: 4mba (more details), 2 Å

PDB Description: aplysia limacina myoglobin. crystallographic analysis at 1.6 angstroms resolution
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d4mbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mbaa_ a.1.1.2 (A:) Myoglobin {Sea hare (Aplysia limacina) [TaxId: 6502]}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOP Domain Coordinates for d4mbaa_:

Click to download the PDB-style file with coordinates for d4mbaa_.
(The format of our PDB-style files is described here.)

Timeline for d4mbaa_: