![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein automated matches [192457] (3 species) not a true protein |
![]() | Species Cowpea (Vigna unguiculata) [TaxId:3917] [192448] (2 PDB entries) |
![]() | Domain d2r33b_: 2r33 B: [151549] Other proteins in same PDB: d2r33a1 automated match to d2bbia_ |
PDB Entry: 2r33 (more details), 2.5 Å
SCOPe Domain Sequences for d2r33b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r33b_ g.3.13.1 (B:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]} pccdscvctksippqchctnirlnschsgcksclctfsipgscrcldianfcykpck
Timeline for d2r33b_: