Lineage for d2r33a1 (2r33 A:17-73)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961886Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 1961887Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1961888Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 1961894Species Cowpea (Vigna unguiculata) [TaxId:3917] [161126] (2 PDB entries)
    Uniprot P17734 17-72! Uniprot Q84X88 44-100
  8. 1961896Domain d2r33a1: 2r33 A:17-73 [151548]
    Other proteins in same PDB: d2r33b_

Details for d2r33a1

PDB Entry: 2r33 (more details), 2.5 Å

PDB Description: Crystal structure of a Bowman-Birk inhibitor from Vigna unguiculata seeds
PDB Compounds: (A:) Bowman-Birk type seed trypsin and chymotrypsin inhibitor

SCOPe Domain Sequences for d2r33a1:

Sequence, based on SEQRES records: (download)

>d2r33a1 g.3.13.1 (A:17-73) Bowman-Birk inhibitor, BBI {Cowpea (Vigna unguiculata) [TaxId: 3917]}
pccdscvctksippqchctnirlnschsgcksclctfsipgscrcldianfcykpck

Sequence, based on observed residues (ATOM records): (download)

>d2r33a1 g.3.13.1 (A:17-73) Bowman-Birk inhibitor, BBI {Cowpea (Vigna unguiculata) [TaxId: 3917]}
pccdscvctksippqchctnirlnschsgcksclctfsgscrcldianfcykpck

SCOPe Domain Coordinates for d2r33a1:

Click to download the PDB-style file with coordinates for d2r33a1.
(The format of our PDB-style files is described here.)

Timeline for d2r33a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2r33b_