![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
![]() | Species Cowpea (Vigna unguiculata) [TaxId:3917] [161126] (2 PDB entries) Uniprot P17734 17-72! Uniprot Q84X88 44-100 |
![]() | Domain d2r33a1: 2r33 A:17-73 [151548] Other proteins in same PDB: d2r33b_ |
PDB Entry: 2r33 (more details), 2.5 Å
SCOPe Domain Sequences for d2r33a1:
Sequence, based on SEQRES records: (download)
>d2r33a1 g.3.13.1 (A:17-73) Bowman-Birk inhibitor, BBI {Cowpea (Vigna unguiculata) [TaxId: 3917]} pccdscvctksippqchctnirlnschsgcksclctfsipgscrcldianfcykpck
>d2r33a1 g.3.13.1 (A:17-73) Bowman-Birk inhibitor, BBI {Cowpea (Vigna unguiculata) [TaxId: 3917]} pccdscvctksippqchctnirlnschsgcksclctfsgscrcldianfcykpck
Timeline for d2r33a1: