Lineage for d2r32a1 (2r32 A:57-176)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2048774Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2048875Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 2048876Species Human (Homo sapiens) [TaxId:9606] [158984] (5 PDB entries)
    Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176
  8. 2048886Domain d2r32a1: 2r32 A:57-176 [151547]
    chimera with a GCN4 helix (excluded)
    complexed with so4

Details for d2r32a1

PDB Entry: 2r32 (more details), 1.95 Å

PDB Description: crystal structure of human gitrl variant
PDB Compounds: (A:) GCN4-pII/Tumor necrosis factor ligand superfamily member 18 fusion protein

SCOPe Domain Sequences for d2r32a1:

Sequence, based on SEQRES records: (download)

>d2r32a1 b.22.1.1 (A:57-176) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnanyndvapfevr
lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqfi

Sequence, based on observed residues (ATOM records): (download)

>d2r32a1 b.22.1.1 (A:57-176) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmappcvnkvsdwkleilqnglyliygqvapnapfevrlyknkdmiq
tltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillanpqfi

SCOPe Domain Coordinates for d2r32a1:

Click to download the PDB-style file with coordinates for d2r32a1.
(The format of our PDB-style files is described here.)

Timeline for d2r32a1: