Lineage for d2r30a1 (2r30 A:57-172)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306419Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1306420Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1306421Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1306522Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 1306523Species Human (Homo sapiens) [TaxId:9606] [158984] (5 PDB entries)
    Uniprot Q9UNG2 55-177! Uniprot Q9UNG2 57-172! Uniprot Q9UNG2 57-176
  8. 1306532Domain d2r30a1: 2r30 A:57-172 [151545]
    mutant

Details for d2r30a1

PDB Entry: 2r30 (more details), 3.2 Å

PDB Description: crystal structure of human gitrl mutant
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d2r30a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r30a1 b.22.1.1 (A:57-172) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Human (Homo sapiens) [TaxId: 9606]}
pcmakfgplpskwqmasseppcvnkvsdwkleilqnglyliygqvapnaayndvapfevr
lyknkdmiqtltnkskiqnvggtyelhvgdtidlifnsehqvlknntywgiillan

SCOPe Domain Coordinates for d2r30a1:

Click to download the PDB-style file with coordinates for d2r30a1.
(The format of our PDB-style files is described here.)

Timeline for d2r30a1: