![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
![]() | Protein Putative hemolysin EF0700 [160831] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [160832] (1 PDB entry) Uniprot Q837X5 350-433 |
![]() | Domain d2r2za1: 2r2z A:5-88 [151544] complexed with zn |
PDB Entry: 2r2z (more details), 1.2 Å
SCOPe Domain Sequences for d2r2za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2za1 d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Enterococcus faecalis [TaxId: 1351]} nlytqvadneylvqgrmlidefnevfetdlhmsdvdtmagylitalgtipdegekpsfev gnikltaeemegtrllvlrvhfyd
Timeline for d2r2za1: