Lineage for d2r2za1 (2r2z A:5-88)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987644Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 2987681Protein Putative hemolysin EF0700 [160831] (1 species)
  7. 2987682Species Enterococcus faecalis [TaxId:1351] [160832] (1 PDB entry)
    Uniprot Q837X5 350-433
  8. 2987683Domain d2r2za1: 2r2z A:5-88 [151544]
    complexed with zn

Details for d2r2za1

PDB Entry: 2r2z (more details), 1.2 Å

PDB Description: The crystal structure of a hemolysin domain from Enterococcus faecalis V583
PDB Compounds: (A:) Hemolysin

SCOPe Domain Sequences for d2r2za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2za1 d.145.1.4 (A:5-88) Putative hemolysin EF0700 {Enterococcus faecalis [TaxId: 1351]}
nlytqvadneylvqgrmlidefnevfetdlhmsdvdtmagylitalgtipdegekpsfev
gnikltaeemegtrllvlrvhfyd

SCOPe Domain Coordinates for d2r2za1:

Click to download the PDB-style file with coordinates for d2r2za1.
(The format of our PDB-style files is described here.)

Timeline for d2r2za1: